PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00011906001
Common NameGSBRNA2T00011906001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LBD
Protein Properties Length: 523aa    MW: 57362.4 Da    PI: 6.5069
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00011906001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260123.51.1e-38309407199
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          +CaaCk+lrr+Ca++C+++pyf  ++p+kfa+vhk+FGasnv+k+l ++ e++r da++slvyeA+ r+rdP+yG++g i++lq+++++l
  GSBRNA2T00011906001 309 PCAACKLLRRRCAEECPFSPYFSPHEPHKFAAVHKVFGASNVSKMLLEVGESQRGDAANSLVYEANLRLRDPIYGCMGAISALQHHIQSL 398
                          7***************************************************************************************** PP

               DUF260  91 kaelallke 99 
                          ++el ++++
  GSBRNA2T00011906001 399 QSELTAVRT 407
                          ****99886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5016411.705169IPR000305GIY-YIG nuclease superfamily
CDDcd104551.77E-37962No hitNo description
PfamPF015411.1E-81060IPR000305GIY-YIG nuclease superfamily
PROSITE profilePS5089125.142308409IPR004883Lateral organ boundaries, LOB
PfamPF031951.5E-39309406IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 523 aa     Download sequence    Send to blast
MSYLFCVLFT VNPKRRIRQH NGEITSGAYR TKKKRPWEMV LCIYGFPTKV SALQFEWAWQ  60
YPRESLAVRE AAASFKSISG LASNTKLAYT ILSLPIWNSL NLTVNYFSSK YAHFVGESGH  120
EAQRNVAIVF PLTLNPTHLG GISPSLPPHM EVHVCPMDDL PCFTKEDDNS QEEDGESPGS  180
NEKEDVGDSS NQNQPGNPIS TYLDDPHLKK AKGPETVLDD RLANFTGFGL LDDSDEDEVP  240
YSTVGSFEAV EKEPEIVFND SREGFGDYYK IVKKVKKDPT FEKTMDHAVM GIRRHVAVPP  300
GTTLNTVTPC AACKLLRRRC AEECPFSPYF SPHEPHKFAA VHKVFGASNV SKMLLEVGES  360
QRGDAANSLV YEANLRLRDP IYGCMGAISA LQHHIQSLQS ELTAVRTDIL RHKYREAATI  420
TSLQNNNNNF NDTTTTSVSD HAALAAAILL PPPLPPPHPP RPPRLLSSQA APPVSLPSPS  480
MMVSSSSSSN SSAANSMYNS PPSSAAGCSN SLSSDNNVHY FD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xlg_A3e-161211032136Structure-specific endonuclease subunit SLX1
4xm5_A3e-161211032136Structure-specific endonuclease subunit SLX1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11334KRRIRQHNGEITSGAYRTKKKR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.51151e-141flower| seed
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013634737.10.0PREDICTED: LOB domain-containing protein 13-like isoform X1
RefseqXP_013659707.10.0PREDICTED: LOB domain-containing protein 13-like isoform X1
RefseqXP_013659708.10.0PREDICTED: LOB domain-containing protein 13-like isoform X1
SwissprotQ9AT611e-123LBD13_ARATH; LOB domain-containing protein 13
TrEMBLA0A078ISF50.0A0A078ISF5_BRANA; BnaCnng25880D protein
STRINGBra021627.1-P0.0(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30340.12e-97LOB domain-containing protein 13
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]